Lineage for d4v0tb_ (4v0t B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395155Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2395156Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2395213Family b.57.1.0: automated matches [272851] (1 protein)
    not a true family
  6. 2395214Protein automated matches [272852] (1 species)
    not a true protein
  7. 2395215Species Suid herpesvirus 1 [TaxId:10345] [272856] (4 PDB entries)
  8. 2395219Domain d4v0tb_: 4v0t B: [274974]
    automated match to d1at3a_

Details for d4v0tb_

PDB Entry: 4v0t (more details), 2.05 Å

PDB Description: monomeric pseudorabies virus protease pul26n at 2.1 a resolution
PDB Compounds: (B:) ul26

SCOPe Domain Sequences for d4v0tb_:

Sequence, based on SEQRES records: (download)

>d4v0tb_ b.57.1.0 (B:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}
mgpvyvsgylalydrdggelaltreivaaalppagplpinidhrprcdigavlavvdddr
gpfflgvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgea
pdetlfahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervw
hmseealtrallstavnnmllrdrwelvaarrreagvrghtyl

Sequence, based on observed residues (ATOM records): (download)

>d4v0tb_ b.57.1.0 (B:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}
mgpvyvsgylalyelaltreivaaalppagplpinidhrprcdigavlavvdddrgpffl
gvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgeapdetl
fahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervwhmsee
altrallsnnmllrdrwelvaarrreagvrghtyl

SCOPe Domain Coordinates for d4v0tb_:

Click to download the PDB-style file with coordinates for d4v0tb_.
(The format of our PDB-style files is described here.)

Timeline for d4v0tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4v0ta_