PDB entry 4ur6

View 4ur6 on RCSB PDB site
Description: Structure of the type III fish antifreeze protein from Zoarces viviparus ZvAFP6
Class: antifreeze protein
Keywords: antifreeze protein, fish, type III, sp isoform
Deposited on 2014-06-26, released 2014-07-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.17965
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type III antifreeze protein 6
  Species: ZOARCES VIVIPARUS [TaxId:48416]
  Database cross-references and differences (RAF-indexed):
  • Uniprot R9S083 (0-End)
• Chain 'B':
  Compound: type III antifreeze protein 6
  Species: ZOARCES VIVIPARUS [TaxId:48416]
  Database cross-references and differences (RAF-indexed):
  • Uniprot R9S083 (0-End)
  Domains in SCOPe 2.04: d4ur6b_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4ur6B (B:)
  gesvvatqlipintaltpammagkvtnpsgipfaemsqivgkqvntpvakgqtlmpdmvk
  tyvpak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ur6B (B:)
  gesvvatqlipintaltpammagkvtnpsgipfaemsqivgkqvntpvakgqtlmpdmvk
  ty