PDB entry 4tw7

View 4tw7 on RCSB PDB site
Description: The Fk1 domain of FKBP51 in complex with iFit4
Class: isomerase
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ligand selectivity, isomerase
Deposited on 2014-06-30, released 2014-11-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.131
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5, AIG6, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • engineered mutation (6)
    Domains in SCOPe 2.04: d4tw7a_
  • Heterogens: 37K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tw7A (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge