PDB entry 4tpi

View 4tpi on RCSB PDB site
Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor
Deposited on 1985-06-11, released 1985-11-08
The last revision prior to the SCOP 1.61 freeze date was dated 1985-11-08, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Domains in SCOP 1.61: d4tpii_
  • Chain 'Z':
    Domains in SCOP 1.61: d4tpiz_

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tpiI (I:)
rpdfcleppytgpcrariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tpiZ (Z:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn