PDB entry 4rrh

View 4rrh on RCSB PDB site
Description: K116M mutant of N-terminal editing domain of threonyl-tRNA synthetase from Aeropyrum pernix with L-Ser3AA
Class: ligase
Keywords: DTD-like fold, Proofreading, LIGASE
Deposited on 2014-11-06, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable threonine--tRNA ligase 2
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: thrS2, APE_0117.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YFY3 (0-135)
      • engineered mutation (115)
    Domains in SCOPe 2.06: d4rrha_
  • Heterogens: A3S, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rrhA (A:)
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwymsfsi
ackghplaelsrsfte