PDB entry 4rrb

View 4rrb on RCSB PDB site
Description: N-terminal editing domain of threonyl-tRNA synthetase from Aeropyrum pernix with L-Thr3AA (snapshot 2)
Class: ligase
Keywords: DTD-like fold, Proofreading, LIGASE
Deposited on 2014-11-06, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable threonine--tRNA ligase 2
    Species: Aeropyrum pernix K1 [TaxId:272557]
    Gene: thrS2, APE_0117.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rrba_
  • Heterogens: A3T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4rrbA (A:)
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwyksfsi
ackghplaelsrsfte