PDB entry 4rca

View 4rca on RCSB PDB site
Description: Crystal structure of human PTPdelta and human Slitrk1 complex
Class: signaling protein
Keywords: Leucine rich-repeat, Ig-like domain, synaptic adhesion, SIGNALING PROTEIN
Deposited on 2014-09-15, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.263
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRD
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SLIT and NTRK-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SLITRK1, KIAA1910, LRRC12, UNQ233/PRO266
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rcab_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rcaB (B:)
    tgdvckekicscneiegdlhvdcekkgftslqrftaptsqfyhlflhgnsltrlfpnefa
    nfynavslhmennglheivpgaflglqlvkrlhinnnkiksfrkqtflglddleylqadf
    nllrdidpgafqdlnklevlilndnlistlpanvfqyvpithldlrgnrlktlpyeevle
    qipgiaeillednpwdctcdllslkewlenipknaligrvvceaptrlqgkdlnetteqd
    lcplksrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rcaB (B:)
    dvckekicscneiegdlhvdcekkgftslqrftaptsqfyhlflhgnsltrlfpnefanf
    ynavslhmennglheivpgaflglqlvkrlhinnnkiksfrkqtflglddleylqadfnl
    lrdidpgafqdlnklevlilndnlistlpanvfqyvpithldlrgnrlktlpyeevleqi
    pgiaeillednpwdctcdllslkewlenipknaligrvvceaptrlqgkdlnetteqdlc
    p