Lineage for d4rcab_ (4rca B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435351Species Human (Homo sapiens) [TaxId:9606] [188042] (18 PDB entries)
  8. 2435378Domain d4rcab_: 4rca B: [345433]
    automated match to d2o6qa_
    complexed with nag, so4

Details for d4rcab_

PDB Entry: 4rca (more details), 2.99 Å

PDB Description: Crystal structure of human PTPdelta and human Slitrk1 complex
PDB Compounds: (B:) SLIT and NTRK-like protein 1

SCOPe Domain Sequences for d4rcab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcab_ c.10.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvckekicscneiegdlhvdcekkgftslqrftaptsqfyhlflhgnsltrlfpnefanf
ynavslhmennglheivpgaflglqlvkrlhinnnkiksfrkqtflglddleylqadfnl
lrdidpgafqdlnklevlilndnlistlpanvfqyvpithldlrgnrlktlpyeevleqi
pgiaeillednpwdctcdllslkewlenipknaligrvvceaptrlqgkdlnetteqdlc
p

SCOPe Domain Coordinates for d4rcab_:

Click to download the PDB-style file with coordinates for d4rcab_.
(The format of our PDB-style files is described here.)

Timeline for d4rcab_:

  • d4rcab_ is new in SCOPe 2.07-stable