PDB entry 4r8n

View 4r8n on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant V23I/V66I/I72V/I92V at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hydrolase, pdtp, cavity, pressure
Deposited on 2014-09-02, released 2014-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (Start-140)
      • conflict (22)
      • conflict (65)
      • conflict (71)
      • conflict (91)
    Domains in SCOPe 2.06: d4r8na_
  • Heterogens: THP, CA, PO4, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4r8nA (A:)
atstkklhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmienakkvevefdkgqrtdkygrglayvyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniws

    Sequence, based on observed residues (ATOM records): (download) 
    >4r8nA (A:)
lhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpvekygpeasaftkkmiena
kkvevefdkgqrtdkygrglayvyadgkmvnealvrqglakvayvykpnntheqhlrkse
aqakkeklniws