PDB entry 4r5r

View 4r5r on RCSB PDB site
Description: Crystal structure of Rhodostomin KKKRT mutant
Class: toxin
Keywords: RGD motif, disintegrin, integrin, toxin, rhodostomin, linker region
Deposited on 2014-08-21, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disintegrin rhodostomin
    Species: Calloselasma rhodostoma [TaxId:8717]
    Gene: RHOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30403 (0-67)
      • engineered mutation (38-42)
    Domains in SCOPe 2.07: d4r5ra_
  • Chain 'B':
    Compound: Disintegrin rhodostomin
    Species: Calloselasma rhodostoma [TaxId:8717]
    Gene: RHOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30403 (0-67)
      • engineered mutation (38-42)
    Domains in SCOPe 2.07: d4r5rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4r5rA (A:)
gkecdcsspenpccdaatcklrpgaqcgeglcceqckfkkkrticriprgdmpddrctgq
sadcpryh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4r5rB (B:)
gkecdcsspenpccdaatcklrpgaqcgeglcceqckfkkkrticriprgdmpddrctgq
sadcpryh