PDB entry 4r0n

View 4r0n on RCSB PDB site
Description: Hexagonal form of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: Nucleotidyltransferase, TRANSFERASE
Deposited on 2014-08-01, released 2014-08-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
• Chain 'C':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
  Domains in SCOPe 2.04: d4r0nc_
• Chain 'E':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
• Chain 'G':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
• Chain 'I':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
• Chain 'K':
  Compound: phosphopantetheine adenylyltransferase
  Species: Mycobacterium tuberculosis BT1 [TaxId:1010836]
  Gene: coaD, HKBT1_3114
  Database cross-references and differences (RAF-indexed):
  • Uniprot W6HGL0 (0-155)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4r0nC (C:)
  tgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestthl
  pnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapr
  ysfvssslakevamlggdvsellpepvnrrlrdrln
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.