PDB entry 4qxf

View 4qxf on RCSB PDB site
Description: crystal structure of human LGR4 and Rspo1
Class: membrane protein
Keywords: ligand-receptor complex, LRR repeats, Beta-Hairpins, Glucosylation, Cell Membrane, MEMBRANE PROTEIN
Deposited on 2014-07-20, released 2014-10-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich repeat-containing G-protein coupled receptor 4, Variable lymphocyte receptor B
    Species: Homo sapiens, Eptatretus burgeri [TaxId:9606, 7764]
    Gene: GPR48, LGR4, VLRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXB1 (2-227)
      • expression tag (0-1)
      • engineered mutation (50)
    • Uniprot Q4G1L2 (228-End)
  • Chain 'B':
    Compound: Leucine-rich repeat-containing G-protein coupled receptor 4, Variable lymphocyte receptor B
    Species: Homo sapiens, Eptatretus burgeri [TaxId:9606, 7764]
    Gene: GPR48, LGR4, VLRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BXB1 (2-227)
      • expression tag (0-1)
      • engineered mutation (50)
    • Uniprot Q4G1L2 (228-300)
  • Chain 'C':
    Compound: r-spondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RSPO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qxfc_
  • Chain 'E':
    Compound: r-spondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RSPO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qxfe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4qxfC (C:)
aegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnk
cikckiehceacfshnfctkckeglylhkgrcypacpegssa

    Sequence, based on observed residues (ATOM records): (download) 
    >4qxfC (C:)
gclkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikckiehceacfshnfc
tkckeglylhkgrcypacp

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >4qxfE (E:)
aegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmnk
cikckiehceacfshnfctkckeglylhkgrcypacpegssa

    Sequence, based on observed residues (ATOM records): (download) 
    >4qxfE (E:)
clkcspklfillerndirqvgvclpscppgyfdarnpdmnkcikckiehceacfshnfct
kckeglylhkgrcypacp