PDB entry 4qql

View 4qql on RCSB PDB site
Description: Crystal structure of C1QL3 in P1 space group
Class: protein binding
Keywords: Jelly roll fold, C1q, Brain-specific angiogenesis inhibitor G-protein coupled receptor 3, extracellular, PROTEIN BINDING
Deposited on 2014-06-27, released 2015-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqla_
  • Chain 'B':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqlb_
  • Chain 'C':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqlc_
  • Chain 'D':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqld_
  • Chain 'E':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqle_
  • Chain 'F':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqlf_
  • Chain 'G':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqlg_
  • Chain 'H':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqlh_
  • Chain 'I':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qqli_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qqlA (A:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlA (A:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qqlB (B:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlB (B:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qqlC (C:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlC (C:)
    pkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdg
    tsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnky
    stfsgfiiyad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qqlD (D:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlD (D:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qqlE (E:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlE (E:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qqlF (F:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlF (F:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qqlG (G:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlG (G:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qqlH (H:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlH (H:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qqlI (I:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqlI (I:)
    pkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdg
    tsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnky
    stfsgfiiyad