Lineage for d4qqlh_ (4qql H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777665Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries)
  8. 2777683Domain d4qqlh_: 4qql H: [271700]
    automated match to d2ka3a_
    complexed with mg

Details for d4qqlh_

PDB Entry: 4qql (more details), 2.39 Å

PDB Description: crystal structure of c1ql3 in p1 space group
PDB Compounds: (H:) Complement C1q-like protein 3

SCOPe Domain Sequences for d4qqlh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqlh_ b.22.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad

SCOPe Domain Coordinates for d4qqlh_:

Click to download the PDB-style file with coordinates for d4qqlh_.
(The format of our PDB-style files is described here.)

Timeline for d4qqlh_: