PDB entry 4qbm

View 4qbm on RCSB PDB site
Description: Crystal structure of human BAZ2A bromodomain in complex with a diacetylated histone 4 peptide (H4K16acK20ac)
Class: Transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2A, Transcription termination factor I-interacting protein 5, Tip5, Bromodomain, Structural Genomics Consortium, SGC, Transcription
Deposited on 2014-05-08, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, CB1_000449039, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF9 (2-105)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4qbma1, d4qbma2
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, CB1_000449039, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF9 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4qbmb1, d4qbmb2
  • Chain 'C':
    Compound: histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu
    Database cross-references and differences (RAF-indexed):
    • PDB 4QBM (0-8)
  • Chain 'D':
    Compound: histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu
    Database cross-references and differences (RAF-indexed):
    • PDB 4QBM (0-8)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qbmA (A:)
    smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
    sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qbmB (B:)
    smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
    sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qbmB (B:)
    smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
    sseefaadallvfdncqtfneddsevgkaghimrrffesrweefy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.