SCOPe 2.08: Domain d4qbmb1: 4qbm B:1796-1898

Lineage for d4qbmb1 (4qbm B:1796-1898)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d4qbmb1: 4qbm B:1796-1898 [257652]
   Other proteins in same PDB: d4qbma2, d4qbmb2
   automated match to d2e7oa_
   complexed with edo

Details for d4qbmb1

PDB Entry: 4qbm, 1.65 Å

PDB Description: crystal structure of human baz2a bromodomain in complex with a diacetylated histone 4 peptide (h4k16ack20ac)

PDB Compounds: (B:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d4qbmb1:

Sequence; same for both SEQRES and ATOM records:

>d4qbmb1 a.29.2.0 (B:1796-1898) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy

Timeline for d4qbmb1:

• d4qbmb1 first appeared in SCOPe 2.04, called d4qbmb_
  
• d4qbmb1 appears in SCOPe 2.07