PDB entry 4qbk

View 4qbk on RCSB PDB site
Description: Crystal structure of the complex of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with amino acyl-tRNA analogue at 1.77 Angstrom resolution
Class: hydrolase
Keywords: Pth, hydrolase
Deposited on 2014-05-08, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.175
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4672, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qbka_
  • Heterogens: GOL, 3NZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qbkA (A:)
    mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
    rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
    iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
    dwtramqklhsqka