PDB entry 4q50

View 4q50 on RCSB PDB site
Description: The Estrogen Receptor Alpha Ligand Binding Domain D538G Mutant in Complex with 4-hydroxytamoxifen
Class: hormone binding protein
Keywords: Acquired SERM-Resistance, Breast Cancer, Activating Mutation, SERM-ER structure, Alpha Helix, Nuclear hormone receptor, hormone binding protein
Deposited on 2014-04-15, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50c_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50d_
  • Chain 'E':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50e_
  • Chain 'F':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50f_
  • Chain 'G':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50g_
  • Chain 'H':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (243)
    Domains in SCOPe 2.07: d4q50h_
  • Heterogens: OHT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q50A (A:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50A (A:)
    alsltadqmvsalldaeppilysmmglltnladrelvhminwakrvpgfvdltlhdqvhl
    lecawleilmiglvwrsmehpkllfapnllldrnqgkgmveifdmllatssrfrmmnlqg
    eefvclksiillnsgvysleekdhihrvldkitdtlihlmakagltlqqqhqrlaqllli
    lshirhmsnkgmehlysvvplyglllemld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q50B (B:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50B (B:)
    alsltadqmvsalldaeppilysemmglltnladrelvhminwakrvpgfvdltlhdqvh
    llecawleilmiglvwrsmehpgkllfapnllldrnqgkcgmveifdmllatssrfrmmn
    lqgeefvclksiillnsgvleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlll
    ilshirhmsnkgmehlysmlyglllemld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q50C (C:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50C (C:)
    lalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdq
    vhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvmveifdmllatssrfrm
    mnlqgeefvclksiillnsgvytsstsleekdhihrvldkitdtlihlmakagltlqqqh
    qrlaqlllilshirhmsnkgmehlysvvplyglllemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4q50D (D:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50D (D:)
    lalsltadqmvsalldaeppilyseasmmglltnladrelvhminwakrvpgfvdltlhd
    qvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllatssr
    frmmnlqgeefvclksiillnsgvksleekdhihrvldkitdtlihlmakagltlqqqhq
    rlaqlllilshirhmsnkgmehlysmlyglllemld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4q50E (E:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50E (E:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvgmveifdmllatssr
    frmmnlqgeefvclksiillnsgvytfsleekdhihrvldkitdtlihlmakagltlqqq
    hqrlaqlllilshirhmsnkgmehlysmlyglllemld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4q50F (F:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50F (F:)
    alsltadqmvsalldaeppilyseypfseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvtfsleekdhihrvldkitdtlihlmakagltl
    qqqhqrlaqlllilshirhmsnkgmehlyslyglllemld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4q50G (G:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50G (G:)
    alsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlhd
    qvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllatssr
    frmmnlqgeefvclksiillnsgvytsleekdhihrvldkitdtlihlmakagltlqqqh
    qrlaqlllilshirhmsnkgmehlysmplyglllemlda
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4q50H (H:)
    snamkrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plyglllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q50H (H:)
    alsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlhd
    qvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllatssr
    frmmnlqgeefvclksiillnsgvytfsleekdhihrvldkitdtlihlmakagltlqqq
    hqrlaqlllilshirhmsnkgmehlyplyglllemlda