PDB entry 4q1w
View 4q1w on RCSB PDB site
Description: Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, AIDS, inhibitor complex, Aspartyl protease, hydrolase-hydrolase inhibitor complex
Deposited on
2014-04-04, released
2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated
2015-02-18, with a file datestamp of
2015-02-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Aspartyl protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
- Uniprot V5Y949 (0-98)
- engineered mutation (6)
- engineered mutation (89)
Domains in SCOPe 2.07: d4q1wa_ - Chain 'B':
Compound: Aspartyl protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
- Uniprot V5Y949 (0-98)
- engineered mutation (6)
- engineered mutation (89)
Domains in SCOPe 2.07: d4q1wb_ - Heterogens: PO4, 017, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4q1wA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4q1wB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlmtqigctlnf