PDB entry 4pvl

View 4pvl on RCSB PDB site
Description: X-ray structure of human transthyretin (TTR) at room temperature to 1.9A resolution
Class: transport protein
Keywords: beta sandwich, transport protein, serum
Deposited on 2014-03-18, released 2014-11-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.156
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pvla_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pvlA (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pvlA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    No sequence available.