PDB entry 4pno

View 4pno on RCSB PDB site
Description: Escherichia coli Hfq-RNA complex at 0.97 A Resolution
Class: RNA binding protein
Keywords: RNA chaperone Hfq RNA LSM, RNA BINDING PROTEIN
Deposited on 2014-05-24, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.144
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Hfq
    Species: Escherichia coli [TaxId:562]
    Gene: hfq, BN17_41491, BU34_16545, ECs5148, LF82_0993
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pnoa_
  • Heterogens: U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4pnoA (A:)
makgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
tvvpsrpvshhs

    Sequence, based on observed residues (ATOM records): (download) 
    >4pnoA (A:)
slqdpflnalrrervpvsiylvngiklqgqiesfdqfvillktvsqmvykhaistvvpsr
pvsh