PDB entry 4pmf

View 4pmf on RCSB PDB site
Description: Human transthyretin (TTR) complexed with curcumin
Class: Thyroid hormone-binding protein
Keywords: Human transthyretin (TTR) complex, hydrophobic ligand solubilization., Thyroid hormone-binding protein
Deposited on 2014-05-21, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.178
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pmfb_
  • Heterogens: CUR, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pmfB (B:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp