PDB entry 4phm

View 4phm on RCSB PDB site
Description: The Structural Basis of Differential Inhibition of Human Calpain by Indole and Phenyl alpha-Mercaptoacrylic Acids
Class: hydrolase
Keywords: Calpain, Domain VI, PEF(S), Human, Calcium Binding, Protease, EF-Hand, hydrolase
Deposited on 2014-05-06, released 2014-08-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4phma_
  • Chain 'B':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 2UD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4phmA (A:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

  • Chain 'B':
    No sequence available.