PDB entry 4p2p

View 4p2p on RCSB PDB site
Description: an independent crystallographic refinement of porcine phospholipase a2 at 2.4 angstroms resolution
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1991-10-22, released 1992-01-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOPe 2.02: d4p2pa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4p2pA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc