PDB entry 4p2a

View 4p2a on RCSB PDB site
Description: Structure of mouse VPS26A bound to rat SNX27 PDZ domain
Class: transport protein
Keywords: retromer, sorting nexin, transport protein
Deposited on 2014-03-03, released 2014-09-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 26A
    Species: Mus musculus [TaxId:10090]
    Gene: VPS26A, VPS26
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sorting nexin-27
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Snx27, Mrt1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K4V4 (6-100)
      • expression tag (4-5)
    Domains in SCOPe 2.04: d4p2ab_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4p2aB (B:)
gshggsprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadrag
vrkgdrilevngvnvegathkqvvdliragekeliltvlsv

    Sequence, based on observed residues (ATOM records): (download) 
    >4p2aB (B:)
gsprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadragvrkg
drilevngvnvegathkqvvdliragekeliltvlsv