PDB entry 4p1q

View 4p1q on RCSB PDB site
Description: green fluorescent protein e222h variant
Class: luminescent protein
Keywords: chromophore, beta-barrel, luminescence, photoprotein, bioluminescence, fluorescent protein, luminescent protein
Deposited on 2014-02-27, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.138
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212 (1-229)
      • expression tag (0)
      • chromophore (64)
      • conflict (78)
      • conflict (97)
      • conflict (151)
      • conflict (161)
      • engineered mutation (220)
    Domains in SCOPe 2.08: d4p1qa1, d4p1qa2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p1qA (A:)
gkgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllhfvtaagith