SCOPe 2.08: Domain d4p1qa1: 4p1q A:3-231

Lineage for d4p1qa1 (4p1q A:3-231)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d4p1qa1: 4p1q A:3-231 [258079]
   Other proteins in same PDB: d4p1qa2
   automated match to d3g9aa_
   complexed with na

Details for d4p1qa1

PDB Entry: 4p1q, 1.5 Å

PDB Description: green fluorescent protein e222h variant

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4p1qa1:

Sequence; same for both SEQRES and ATOM records:

>d4p1qa1 d.22.1.1 (A:3-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllhfvtaagith

Timeline for d4p1qa1:

• d4p1qa1 first appeared in SCOPe 2.04, called d4p1qa_
  
• d4p1qa1 appears in SCOPe 2.07