PDB entry 4p13

View 4p13 on RCSB PDB site
Description: Medium chain acyl-CoA dehydrogenase, K304E mutant
Class: oxidoreductase
Keywords: tetramer, dehydrogenase, oxidase, OXIDOREDUCTASE
Deposited on 2014-02-14, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ACADM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (0-386)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d4p13a1, d4p13a2
  • Chain 'B':
    Compound: Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ACADM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (0-End)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d4p13b1, d4p13b2
  • Chain 'C':
    Compound: Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ACADM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (0-386)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d4p13c1, d4p13c2
  • Chain 'D':
    Compound: Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ACADM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11310 (0-End)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d4p13d1, d4p13d2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p13A (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p13B (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p13B (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkyk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p13C (C:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4p13D (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p13D (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamevelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkyk