![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
![]() | Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries) Uniprot P11310 34-421 |
![]() | Domain d4p13a1: 4p13 A:10-241 [270325] Other proteins in same PDB: d4p13a2, d4p13b2, d4p13c2, d4p13d2 automated match to d1egda2 complexed with fad; mutant |
PDB Entry: 4p13 (more details), 1.73 Å
SCOPe Domain Sequences for d4p13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p13a1 e.6.1.1 (A:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd
Timeline for d4p13a1: