PDB entry 4os2

View 4os2 on RCSB PDB site
Description: Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK602 (bicyclic 1)
Class: hydrolase/hydrolase inhibitor
Keywords: bicyclic peptide, inhibitor, protease, disulfide bridges, cyclization, extracellular, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-02-12, released 2014-09-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • engineered mutation (120)
      • engineered mutation (143)
    Domains in SCOPe 2.05: d4os2a_
  • Chain 'B':
    Compound: bicyclic peptide UK602 (bicyclic 1)
    Database cross-references and differences (RAF-indexed):
    • PDB 4OS2 (0-End)
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4os2A (A:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

  • Chain 'B':
    No sequence available.