Lineage for d4os2a_ (4os2 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794839Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1794840Species Human (Homo sapiens) [TaxId:9606] [50587] (72 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1794884Domain d4os2a_: 4os2 A: [267096]
    automated match to d4h42u_
    complexed with act, so4

Details for d4os2a_

PDB Entry: 4os2 (more details), 1.79 Å

PDB Description: crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk602 (bicyclic 1)
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4os2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4os2a_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

SCOPe Domain Coordinates for d4os2a_:

Click to download the PDB-style file with coordinates for d4os2a_.
(The format of our PDB-style files is described here.)

Timeline for d4os2a_: