PDB entry 4omw

View 4omw on RCSB PDB site
Description: Crystal structure of goat beta-lactoglobulin (orthorhombic form)
Class: transport protein
Keywords: lipocalin, transport, TRANSPORT PROTEIN
Deposited on 2014-01-27, released 2014-11-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Capra hircus [TaxId:9925]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02756 (0-161)
• Chain 'B':
  Compound: beta-lactoglobulin
  Species: Capra hircus [TaxId:9925]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02756 (0-161)
• Chain 'C':
  Compound: beta-lactoglobulin
  Species: Capra hircus [TaxId:9925]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02756 (0-161)
• Chain 'D':
  Compound: beta-lactoglobulin
  Species: Capra hircus [TaxId:9925]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02756 (0-161)
  Domains in SCOPe 2.04: d4omwd_
• Heterogens: GOL, SO4, TE4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4omwD (D:)
  iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevdkealekfdkalkalpmhirlafnptqlegqchv