SCOPe 2.06: Structural Classification of Proteins

PDB entry 4off

View 4off on RCSB PDB site
Description: Crystal structure of apo carboxy cGMP binding domain of Plasmodium falciparum PKG
Class: transferase
Keywords: Phosphate binding cassette/Cyclic GMP binding domain/PKG, Serine/threonine kinase, TF2I, IRAG, cGMP binding, TRANSFERASE
Deposited on 2014-01-14, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: CGMP-dependent protein kinase
Species: Plasmodium falciparum [TaxId:5833]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8MMZ4
Domains in SCOPe 2.06: d4offa_
Heterogens: SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4offA (A:)
gsdasidynnkksiikkmyifryltdkqcnllieafrttryeegdyiiqegevgsrfyii
kngeveivknkkrlrtlgkndyfgerallydeprtasviskvnnvecwfvdksvflqiiq
gpmlahleerikmqdtkvemdele

Sequence, based on observed residues (ATOM records): (download)

>4offA (A:)
sidynnkksiikkmyifryltdkqcnllieafrttryeegdyiiqegevgsrfyiiknge
veivknkkrlrtlgkndyfgerallydeprtasviskvnnvecwfvdksvflqiiqgpml
ahle