PDB entry 4o5b

View 4o5b on RCSB PDB site
Description: HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor (2S)-tert-butoxy[6-(5-chloro-1H-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
Class: viral protein/inhibitor
Keywords: HIV Integrase, CCD, DDE motif, allosteric inhibitor, VIRAL PROTEIN, VIRAL PROTEIN-INHIBITOR complex
Deposited on 2013-12-19, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (78)
      • conflict (135)
    Domains in SCOPe 2.07: d4o5ba_
  • Heterogens: LF9, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4o5bA (A:)
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke

    Sequence, based on observed residues (ATOM records): (download) 
    >4o5bA (A:)
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnk
krkggysagerivdiiatdiq