PDB entry 4o3f

View 4o3f on RCSB PDB site
Description: Crystal Structure of mouse PGK1 3PG and terazosin(TZN) ternary complex
Class: transferase/transferase activator
Keywords: ENZYME-DRUG COMPLEX, TRANSFERASE-TRANSFERASE ACTIVATOR complex
Deposited on 2013-12-18, released 2014-10-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pgk1, Pgk-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4o3fa_
  • Heterogens: TZN, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o3fA (A:)
    mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
    mshlgrpdgvpmpdkyslepvaaelksllgkdvlflkdcvgpevenacanpaagtville
    nlrfhveeegkgkdasgnkvkaepakidafraslsklgdvyvndafgtahrahssmvgvn
    lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
    aftflkvlnnmeigtslydeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
    atvasgipagwmgldcgtesskkyaeavgrakqivwngpvgvfeweafargtkslmdevv
    katsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o3fA (A:)
    mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
    mshlgrpdgvpmpdkyslepvaaelksllgkdvlflkdcvgpevenacanpaagtville
    nlrfhveeegkgkdasgnkvkaepakidafraslsklgdvyvndafgtahrahssmvgvn
    lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
    aftflkvlnnmeigtslydeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
    atvasgipagwmgldcgtesskkyaeavgrakqivwngpvgvfeweafargtkslmdevv
    katsrgcitiigggdtatdkvshvstgggaslellegkvlpgvdalsnv