PDB entry 4nw7

View 4nw7 on RCSB PDB site
Description: PDE4 catalytic domain
Class: hydrolase/hydrolase inhibitor
Keywords: PHOSPHODIESTERASE, PDE4, CATALYTIC, hydrolase-hydrolase inhibitor complex
Deposited on 2013-12-05, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.158
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4, PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4nw7a1, d4nw7a2
  • Heterogens: ZN, MG, NA, 2O5, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nw7A (A:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nw7A (A:)
    hmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktf
    rissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaif
    aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkk
    qrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvh
    cadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidy
    ivhplwetwadlvqpdaqdildtlednrnwyqsmipqlmekfqf