Lineage for d4nw7a1 (4nw7 A:324-680)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015191Protein automated matches [190370] (1 species)
    not a true protein
  7. 2015192Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2015206Domain d4nw7a1: 4nw7 A:324-680 [260343]
    Other proteins in same PDB: d4nw7a2
    automated match to d3hmva_
    complexed with 2o5, edo, mg, na, zn

Details for d4nw7a1

PDB Entry: 4nw7 (more details), 2.15 Å

PDB Description: PDE4 catalytic domain
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d4nw7a1:

Sequence, based on SEQRES records: (download)

>d4nw7a1 a.211.1.2 (A:324-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfqf

Sequence, based on observed residues (ATOM records): (download)

>d4nw7a1 a.211.1.2 (A:324-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqlmekfqf

SCOPe Domain Coordinates for d4nw7a1:

Click to download the PDB-style file with coordinates for d4nw7a1.
(The format of our PDB-style files is described here.)

Timeline for d4nw7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nw7a2