PDB entry 4ng4

View 4ng4 on RCSB PDB site
Description: Structure of phosphoglycerate kinase (CBU_1782) from Coxiella burnetii
Class: transferase
Keywords: phosphoglycerate kinase, TRANSFERASE
Deposited on 2013-11-01, released 2015-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_1782, pgk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83AU6 (16-End)
      • see remark 999 (12-15)
    Domains in SCOPe 2.08: d4ng4a_
  • Chain 'B':
    Compound: phosphoglycerate kinase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_1782, pgk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83AU6 (16-End)
      • see remark 999 (12-15)
    Domains in SCOPe 2.08: d4ng4b_
  • Chain 'C':
    Compound: phosphoglycerate kinase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: CBU_1782, pgk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83AU6 (16-403)
      • see remark 999 (12-15)
    Domains in SCOPe 2.08: d4ng4c_
  • Heterogens: MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ng4A (A:)
    snamsenkmkalpflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaie
    qkarvmilshlgrpeegkfekefslapvarllskklnqkvplindwlkgvavepgqailc
    envrfnkgenenntelakrmaelcdifvmdafatahraqastagvaayaklacagpllis
    evealsralenpqkplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysi
    gkslcenewldaaqqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesif
    dvgpntsatyaklmaqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtl
    aaldkfnltdqmsyvstaggafleflegkilpaikiltqrakey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ng4A (A:)
    pflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaieqkarvmilshlg
    rpeegkfekefslapvarllskkplindwlkgvavepgqailcenvrfnkgenenntela
    krmaelcdifvmdafatahraqastagvaayaklacagpllisevealsralenpqkplv
    avvggskvstkihllenlldkvdqlivgggiantflkaqgysigkslcenewldaaqqfw
    ekaaeknvslplpvdvivadelsedakatvknidavtsnesifdvgpntsatyaklmaqa
    gtivwngpigvfeieafsqgtralaqavakstaysivgggdtlaaldkfnltdqmsyvst
    aggafleflegklpaikiltqrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ng4B (B:)
    snamsenkmkalpflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaie
    qkarvmilshlgrpeegkfekefslapvarllskklnqkvplindwlkgvavepgqailc
    envrfnkgenenntelakrmaelcdifvmdafatahraqastagvaayaklacagpllis
    evealsralenpqkplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysi
    gkslcenewldaaqqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesif
    dvgpntsatyaklmaqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtl
    aaldkfnltdqmsyvstaggafleflegkilpaikiltqrakey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ng4B (B:)
    pflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaieqkarvmilshlg
    rpeegkfekefslapvarllskklnkvplindwlkgvavepgqailcenvrfnkgenenn
    telakrmaelcdifvmdafatahraqastagvaayaklacagpllisevealsralenpq
    kplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysigkslcenewldaa
    qqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesifdvgpntsatyakl
    maqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtlaaldkfnltdqms
    yvstaggafleflegkilpaikiltqrak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ng4C (C:)
    snamsenkmkalpflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaie
    qkarvmilshlgrpeegkfekefslapvarllskklnqkvplindwlkgvavepgqailc
    envrfnkgenenntelakrmaelcdifvmdafatahraqastagvaayaklacagpllis
    evealsralenpqkplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysi
    gkslcenewldaaqqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesif
    dvgpntsatyaklmaqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtl
    aaldkfnltdqmsyvstaggafleflegkilpaikiltqrakey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ng4C (C:)
    pflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaieqkarvmilshlg
    rpeegkfekefslapvarllskklnvplindwlkgvavepgqailcenvrfnkgenennt
    elakrmaelcdifvmdafatahraqastagvaayaklacagpllisevealsralenpqk
    plvavvggskvstkihllenlldkvdqlivgggiantflkaqgysigkslcenewldaaq
    qfwekaaeknvslplpvdvivadelsedakatvknidavtsnesifdvgpntsatyaklm
    aqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtlaaldkfnltdqmsy
    vstaggaflefleglpaikiltqrakey