Lineage for d4ng4b_ (4ng4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2142023Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 2142024Protein automated matches [190573] (5 species)
    not a true protein
  7. 2142035Species Coxiella burnetii [TaxId:227377] [274225] (1 PDB entry)
  8. 2142037Domain d4ng4b_: 4ng4 B: [274226]
    automated match to d1zmra_
    complexed with adp, mg

Details for d4ng4b_

PDB Entry: 4ng4 (more details), 2.78 Å

PDB Description: structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d4ng4b_:

Sequence, based on SEQRES records: (download)

>d4ng4b_ c.86.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
pflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaieqkarvmilshlg
rpeegkfekefslapvarllskklnqkvplindwlkgvavepgqailcenvrfnkgenen
ntelakrmaelcdifvmdafatahraqastagvaayaklacagpllisevealsralenp
qkplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysigkslcenewlda
aqqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesifdvgpntsatyak
lmaqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtlaaldkfnltdqm
syvstaggafleflegkilpaikiltqrak

Sequence, based on observed residues (ATOM records): (download)

>d4ng4b_ c.86.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
pflsmsnlnlhnkrvmiredlnvpmkngkitnderivralptiqkaieqkarvmilshlg
rpeegkfekefslapvarllskklnkvplindwlkgvavepgqailcenvrfnkgenenn
telakrmaelcdifvmdafatahraqastagvaayaklacagpllisevealsralenpq
kplvavvggskvstkihllenlldkvdqlivgggiantflkaqgysigkslcenewldaa
qqfwekaaeknvslplpvdvivadelsedakatvknidavtsnesifdvgpntsatyakl
maqagtivwngpigvfeieafsqgtralaqavakstaysivgggdtlaaldkfnltdqms
yvstaggafleflegkilpaikiltqrak

SCOPe Domain Coordinates for d4ng4b_:

Click to download the PDB-style file with coordinates for d4ng4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ng4b_: