PDB entry 4ml0

View 4ml0 on RCSB PDB site
Description: Crystal structure of E.coli DinJ-YafQ complex
Class: toxin/antitoxin
Keywords: RHH motif, interferase, TOXIN-ANTITOXIN complex
Deposited on 2013-09-06, released 2014-06-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ml0b_
  • Chain 'C':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: dinJ, ECB_00221
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
    Species: Escherichia coli [TaxId:413997]
    Gene: yafQ, ECB_00220
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ml0B (B:)
    stgmiqrdieysgqfskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqsswk
    gyrdahvepdwiliykltdkllrfertgthaalfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ml0B (B:)
    qrdieysgqfskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqsswkgyrda
    hvepdwiliykltdkllrfertgthaalfg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.