PDB entry 4ml0

View 4ml0 on RCSB PDB site
Description: Crystal structure of E.coli DinJ-YafQ complex
Class: toxin/antitoxin
Keywords: RHH motif, interferase, TOXIN-ANTITOXIN complex
Deposited on 2013-09-06, released 2014-06-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'B':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
  Domains in SCOPe 2.04: d4ml0b_
• Chain 'C':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'D':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'E':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'F':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'G':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'H':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'I':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'J':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'K':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'L':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'M':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'N':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Chain 'O':
  Compound: Predicted antitoxin of YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: dinJ, ECB_00221
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV3 (Start-88)
• Chain 'P':
  Compound: Predicted toxin of the YafQ-DinJ toxin-antitoxin system
  Species: Escherichia coli [TaxId:413997]
  Gene: yafQ, ECB_00220
  Database cross-references and differences (RAF-indexed):
  • Uniprot C6UAV2 (Start-94)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4ml0B (B:)
  stgmiqrdieysgqfskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqsswk
  gyrdahvepdwiliykltdkllrfertgthaalfg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ml0B (B:)
  qrdieysgqfskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqsswkgyrda
  hvepdwiliykltdkllrfertgthaalfg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.