PDB entry 4mhe

View 4mhe on RCSB PDB site
Description: Crystal structure of CC-chemokine 18
Class: immune system
Keywords: Greek key shape, IMMUNE SYSTEM
Deposited on 2013-08-29, released 2014-09-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 18
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55774 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: C-C motif chemokine 18
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55774 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d4mheb_
  • Chain 'C':
    Compound: C-C motif chemokine 18
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: C-C motif chemokine 18
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4mheB (B:)
saqvgtnkelcclvytswqipqkfivdysetspqcpkpgvilltkrgrqicadpnkkwvq
kyisdlklna

    Sequence, based on observed residues (ATOM records): (download) 
    >4mheB (B:)
saqvgtnkelcclvytswqipqkfivdysetspqcpkpgvilltkrgrqicadpnkkwvq
kyisdlkln

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.