PDB entry 4mfh

View 4mfh on RCSB PDB site
Description: Crystal Structure of M121G Azurin
Class: electron transport
Keywords: Greek Key beta-Barrel, Electron transfer, Periplasmic, ELECTRON TRANSPORT
Deposited on 2013-08-27, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered mutation (120)
  Domains in SCOPe 2.07: d4mfha_
• Chain 'B':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered mutation (120)
  Domains in SCOPe 2.07: d4mfhb_
• Chain 'C':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered mutation (120)
  Domains in SCOPe 2.07: d4mfhc_
• Heterogens: CU, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4mfhA (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  gkgtltlk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4mfhB (B:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  gkgtltlk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4mfhC (C:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  gkgtltlk