PDB entry 4mei

View 4mei on RCSB PDB site
Description: Crystal structure of a VirB8 Type IV secretion system machinery soluble domain from Bartonella tribocorum
Class: protein transport
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, transmembrane protein, type IV secretion system, T4SS, PROTEIN TRANSPORT
Deposited on 2013-08-26, released 2014-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VirB8 protein
    Species: Bartonella tribocorum [TaxId:382640]
    Gene: BT_1695, virB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4meia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4meiA (A:)
    mahhhhhhmaltplktvepfvirvdnstgiidtvsalkespsdydeaitryfasqyvrar
    egfqaseaensfrlvsllsspkeqnrfakwyagnnpespqniyhnmiatvtiksisfisk
    dliqvryyktvrdfseketishwvsilnfsyvnahistsdrlinplgfqvseyrsdpevi
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4meiA (A:)
    ydeaitryfasqyvraregfqaseaensfrlvsllsspkeqnrfakwyagnnpespqniy
    hnmiatvtiksisfiskdliqvryyktvrdfseketishwvsilnfsyvnahistsdrli
    nplgfqvseyrsdpev