PDB entry 4mag

View 4mag on RCSB PDB site
Description: Crystal structure of the Periplasmic Sialic Acid Binding Protein from Vibrio Cholerea
Class: sugar binding protein
Keywords: sialic acid binding and transport SiaP, SUGAR BINDING PROTEIN
Deposited on 2013-08-16, released 2014-07-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.184
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic Acid Binding Protein
    Species: Vibrio cholerae [TaxId:593588]
    Gene: siap, VCD_002591
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3NPP8 (0-298)
      • expression tag (299-306)
    Domains in SCOPe 2.04: d4maga_
  • Heterogens: CO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4magA (A:)
    attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqqltlgdl
    dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
    yngtrettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevylalqtnav
    dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
    dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaaml
    qhhhhhh