PDB entry 4m7m

View 4m7m on RCSB PDB site
Description: Crystal structure of the R111K:R132Q:Y134F:T54V:R59W:A32W mutant of the Cellular Retinoic Acid Binding Protein Type II in complex with All-Trans Retinal at 2.57 Angstrom Resolution
Class: transport protein
Keywords: protein engineering, wavelength regulation, pH-sensing, Retinylidene PSB, Iminium, TRANSPORT PROTEIN
Deposited on 2013-08-12, released 2013-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (31)
      • engineered mutation (53)
      • engineered mutation (58)
      • engineered mutation (110)
      • engineered mutation (131)
      • engineered mutation (133)
    Domains in SCOPe 2.06: d4m7ma_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4m7mA (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiwvaaaskpaveikqegdtfyikvsttvwt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctqvfvre