PDB entry 4lwu

View 4lwu on RCSB PDB site
Description: The 1.14A Crystal Structure of Humanized Xenopus MDM2 with RO5499252
Class: Ligase/Ligase inhibitor
Keywords: MDM2, Spiroindolinone, E3 Ubiquitin Ligase, p53, Nucleus, Ligase-Ligase inhibitor complex
Deposited on 2013-07-28, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.216
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (0-84)
      • engineered mutation (29)
      • engineered mutation (71)
      • engineered mutation (74)
    Domains in SCOPe 2.04: d4lwua_
  • Heterogens: 20U, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lwuA (A:)
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlvs