PDB entry 4luo

View 4luo on RCSB PDB site
Description: Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions
Class: protein binding
Keywords: ob-fold, protein-protein interaction, protein binding
Deposited on 2013-07-25, released 2013-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27694 (3-122)
      • expression tag (0-2)
      • engineered mutation (9)
    Domains in SCOPe 2.04: d4luoa_
  • Heterogens: 1DZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4luoA (A:)
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne