PDB entry 4lro

View 4lro on RCSB PDB site
Description: Crystal structure of spermidine inhibited Ribosome inactivating protein from Momordica balsamina
Class: Hydrolase
Keywords: Ribosome inactivating protein, Complex hydrolase, Ligand binding, Hydrolase, Spermidine
Deposited on 2013-07-20, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosidase
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lroa_
  • Heterogens: NAG, GOL, SPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lroA (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni