PDB entry 4lov

View 4lov on RCSB PDB site
Description: Crystal structure of FimH in complex with Heptylmannoside
Class: carbohydrate binding protein
Keywords: Pilus subunit, Ig fold, CARBOHYDRATE BINDING PROTEIN
Deposited on 2013-07-13, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein fimh
  Species: Escherichia coli [TaxId:562]
  Gene: fimH, b4320, JW4283
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.07: d4lova_
• Heterogens: KGM, GOL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lovA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt