PDB entry 4ln1

View 4ln1 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF L-lactate dehydrogenase from Bacillus cereus ATCC 14579 complexed with calcium, NYSGRC Target 029452
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, OXIDOREDUCTASE
Deposited on 2013-07-11, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EP4 (22-335)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d4ln1a1, d4ln1a2, d4ln1a3
  • Chain 'B':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EP4 (22-335)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d4ln1b1, d4ln1b2, d4ln1b3
  • Chain 'C':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EP4 (22-335)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d4ln1c1, d4ln1c2, d4ln1c3
  • Chain 'D':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EP4 (22-335)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d4ln1d1, d4ln1d2, d4ln1d3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ln1A (A:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln1A (A:)
    enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
    vpfapaptrvwkgsyedckdadlvvitaglpqtrldlveknakifkqivrsimdsgfdgi
    fliatnpvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihayiige
    hgdtelpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgatyygig
    msllrvtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelsedeel
    kfdhsvqvlketmapvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ln1B (B:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln1B (B:)
    enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
    vpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsg
    fdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihay
    iigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgaty
    ygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelse
    deelkfdhsvqvlketmapvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ln1C (C:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln1C (C:)
    enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
    vpfapaptrvwkgsyedckdadlvvitaglptrldlveknakifkqivrsimdsgfdgif
    liatnpvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihayiigeh
    gdtelpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgatyygigm
    sllrvtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelsedeelk
    fdhsvqvlketmapvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ln1D (D:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln1D (D:)
    enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
    vpfapaptrvwkgsyedckdadlvvitaglprldlveknakifkqivrsimdsgfdgifl
    iatnpvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihayiigehg
    dtelpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgatyygigms
    llrvtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelsedeelkf
    dhsvqvlketmapvl